PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_94E5996F7.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 134aa    MW: 14717.4 Da    PI: 10.6027
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_94E5996F7.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.51.7e-1460116662
                            HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                            + +r++kNRe+A rsR+RK+a+++eLe++v  L + N +Lk + + l+ e+a+l+++
  Traes_2BL_94E5996F7.1  60 KSIRAMKNRESALRSRARKRAYTQELEKEVRRLVEDNLKLKRQCKLLQSEIAALTAQ 116
                            679*************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1154119IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.50757113IPR004827Basic-leucine zipper domain
PfamPF001701.6E-1160115IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-1260115No hitNo description
Gene3DG3DSA:1.20.5.1709.1E-1462116No hitNo description
CDDcd147078.62E-1863113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MSWEEPGSPQ LSLSGFSSLP SISSTAHPPA RLPSLSLSIG NGSADGEDQQ LGVSSDDGHK  60
SIRAMKNRES ALRSRARKRA YTQELEKEVR RLVEDNLKLK RQCKLLQSEI AALTAQQASN  120
KQSSPHRRTS STQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3071160.0EU307116.1 Triticum aestivum FD-like 15 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439039.19e-33hypothetical protein SORBIDRAFT_10g030400
RefseqXP_004966480.18e-33PREDICTED: protein FD-like
TrEMBLB4Y1F06e-93B4Y1F0_WHEAT; FD-like 15 protein
STRINGMLOC_10399.12e-77(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-11bZIP family protein
Publications ? help Back to Top
  1. Li C,Dubcovsky J
    Wheat FT protein regulates VRN1 transcription through interactions with FDL2.
    Plant J., 2008. 55(4): p. 543-54
    [PMID:18433437]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]